Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (6 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries) |
Domain d4h32g_: 4h32 G: [222358] Other proteins in same PDB: d4h32b_, d4h32d_, d4h32f_, d4h32h_, d4h32j_, d4h32l_ automated match to d1rd8a_ complexed with nag |
PDB Entry: 4h32 (more details), 2.7 Å
SCOPe Domain Sequences for d4h32g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h32g_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign cpkyvkatslmlatglrnnp
Timeline for d4h32g_: