Lineage for d4h32g_ (4h32 G:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305775Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)
  8. 1305904Domain d4h32g_: 4h32 G: [222358]
    automated match to d1rd8a_
    complexed with nag

Details for d4h32g_

PDB Entry: 4h32 (more details), 2.7 Å

PDB Description: The crystal structure of the hemagglutinin H17 derived the bat influenza A virus
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4h32g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h32g_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlag
wllgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnp
qsmtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntk
daaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlrie
stgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtign
cpkyvkatslmlatglrnnp

SCOPe Domain Coordinates for d4h32g_:

Click to download the PDB-style file with coordinates for d4h32g_.
(The format of our PDB-style files is described here.)

Timeline for d4h32g_: