Lineage for d4h32c1 (4h32 C:5-323)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775802Domain d4h32c1: 4h32 C:5-323 [222356]
    Other proteins in same PDB: d4h32a2, d4h32b_, d4h32c2, d4h32d_, d4h32e2, d4h32f_, d4h32g2, d4h32h_, d4h32i2, d4h32j_, d4h32k2, d4h32l_
    automated match to d1rd8a_
    complexed with nag

Details for d4h32c1

PDB Entry: 4h32 (more details), 2.7 Å

PDB Description: the crystal structure of the hemagglutinin h17 derived the bat influenza a virus
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4h32c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h32c1 b.19.1.2 (C:5-323) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dricigyqanqnnqtvntlleqnvpvtgaqeiletnhngklcslngvppldlqsctlagw
llgnpncdnlleaeewsyikinenapddlcfpgnfenlqdlllemsgvqnftkvklfnpq
smtgvttnnvdqtcpfegkpsfyrnlnwiqgnsglpfnieiknptsnpllllwgihntkd
aaqqrnlygndysytifnfgekseefrpdigqrdeikahqdridyywgslpaqstlries
tgnliapeygfyykrkegkgglmksklpisdcstkcqtplgalnstlpfqnvhqqtignc
pkyvkatslmlatglrnnp

SCOPe Domain Coordinates for d4h32c1:

Click to download the PDB-style file with coordinates for d4h32c1.
(The format of our PDB-style files is described here.)

Timeline for d4h32c1: