SCOPe 2.07: Domain d4h31c1: 4h31 C:1-152

Lineage for d4h31c1 (4h31 C:1-152)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)

8. Domain d4h31c1: 4h31 C:1-152 [222353]
   Other proteins in same PDB: d4h31a3
   automated match to d1duvg1
   complexed with cl, cp, nva, pe5, peg

Details for d4h31c1

PDB Entry: 4h31, 1.7 Å

PDB Description: Crystal structure of anabolic ornithine carbamoyltransferase from Vibrio vulnificus in complex with carbamoyl phosphate and L-norvaline

PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4h31c1:

Sequence; same for both SEQRES and ATOM records:

>d4h31c1 c.78.1.0 (C:1-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
mafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialifekastrt
rcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqaiveelga
fagvpvwngltdefhptqiladfltmlehsqg

Timeline for d4h31c1:

• d4h31c1 first appeared in SCOPe 2.03
  
• d4h31c1 appears in SCOPe 2.06