Lineage for d4h31a1 (4h31 A:1-152)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2907275Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)
  8. 2907276Domain d4h31a1: 4h31 A:1-152 [222349]
    Other proteins in same PDB: d4h31a3
    automated match to d1duvg1
    complexed with cl, cp, nva, pe5, peg

Details for d4h31a1

PDB Entry: 4h31 (more details), 1.7 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate and l-norvaline
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4h31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h31a1 c.78.1.0 (A:1-152) automated matches {Vibrio vulnificus [TaxId: 216895]}
mafnlrnrnflklldfstkeiqflidlsadlkkakyagteqkkllgknialifekastrt
rcafevaafdqgaqvtyigpsgsqigdkesmkdtarvlgrmydgiqyrgfgqaiveelga
fagvpvwngltdefhptqiladfltmlehsqg

SCOPe Domain Coordinates for d4h31a1:

Click to download the PDB-style file with coordinates for d4h31a1.
(The format of our PDB-style files is described here.)

Timeline for d4h31a1: