| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein automated matches [190286] (9 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries) |
| Domain d4h2yd_: 4h2y D: [222347] Other proteins in same PDB: d4h2yc2 automated match to d2jq4a1 protein/RNA complex; complexed with atp, mg, pns, zn |
PDB Entry: 4h2y (more details), 2.1 Å
SCOPe Domain Sequences for d4h2yd_:
Sequence, based on SEQRES records: (download)
>d4h2yd_ a.28.1.1 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
natireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnrk
sfasikaiedtvkl
>d4h2yd_ a.28.1.1 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
natireilakfgqlplyaaglssfasvqlmlgieeafdiefpdnllnrksfasikaiedt
vkl
Timeline for d4h2yd_: