Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
Protein automated matches [190286] (9 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries) |
Domain d4h2xd_: 4h2x D: [222345] Other proteins in same PDB: d4h2xc2 automated match to d2jq4a1 protein/RNA complex; complexed with cl, g5a, pns, zn |
PDB Entry: 4h2x (more details), 2.15 Å
SCOPe Domain Sequences for d4h2xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h2xd_ a.28.1.1 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} mnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnllnr ksfasikaiedtvkl
Timeline for d4h2xd_: