Lineage for d1cobb_ (1cob B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763770Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)
  8. 2763802Domain d1cobb_: 1cob B: [22234]
    complexed with co, cu

Details for d1cobb_

PDB Entry: 1cob (more details), 2 Å

PDB Description: crystal structure solution and refinement of the semisynthetic cobalt substituted bovine erythrocyte enzyme superoxide dismutase at 2.0 angstroms resolution
PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1cobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cobb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOPe Domain Coordinates for d1cobb_:

Click to download the PDB-style file with coordinates for d1cobb_.
(The format of our PDB-style files is described here.)

Timeline for d1cobb_: