SCOPe 2.03: Domain d4h2eb_: 4h2e B:

Lineage for d4h2eb_ (4h2e B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Gelatinase B (MMP-9) [75496] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75497] (13 PDB entries)

8. Domain d4h2eb_: 4h2e B: [222335]
   automated match to d2y6da_
   complexed with 0y3, act, bcn, ca, peg, zn

Details for d4h2eb_

PDB Entry: 4h2e, 2.9 Å

PDB Description: crystal structure of an mmp twin inhibitor complexing two mmp-9 catalytic domains

PDB Compounds: (B:) human MMP-9 catalytic domain wild-type

SCOPe Domain Sequences for d4h2eb_:

Sequence; same for both SEQRES and ATOM records:

>d4h2eb_ d.92.1.11 (B:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
gfqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdad
iviqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaa
hefghalgldhssvpealmypmyrftegpplhkddvngirhlyg

Timeline for d4h2eb_:

• d4h2eb_ is new in SCOPe 2.03-stable
  
• d4h2eb_ appears in SCOPe 2.04
  
• d4h2eb_ appears in the current release, SCOPe 2.08, called d4h2eb1