Lineage for d4h2ea1 (4h2e A:107-269)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205700Protein Gelatinase B (MMP-9) [75496] (1 species)
  7. 2205701Species Human (Homo sapiens) [TaxId:9606] [75497] (16 PDB entries)
  8. 2205731Domain d4h2ea1: 4h2e A:107-269 [222334]
    Other proteins in same PDB: d4h2ea2, d4h2eb2
    automated match to d2y6da_
    complexed with 0y3, act, bcn, ca, peg, zn

Details for d4h2ea1

PDB Entry: 4h2e (more details), 2.9 Å

PDB Description: crystal structure of an mmp twin inhibitor complexing two mmp-9 catalytic domains
PDB Compounds: (A:) human MMP-9 catalytic domain wild-type

SCOPe Domain Sequences for d4h2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2ea1 d.92.1.11 (A:107-269) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}
fqtfegdlkwhhhnitywiqnysedlpraviddafarafalwsavtpltftrvysrdadi
viqfgvaehgdgypfdgkdgllahafppgpgiqgdahfdddelwslgkgvgyslflvaah
efghalgldhssvpealmypmyrftegpplhkddvngirhlyg

SCOPe Domain Coordinates for d4h2ea1:

Click to download the PDB-style file with coordinates for d4h2ea1.
(The format of our PDB-style files is described here.)

Timeline for d4h2ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h2ea2