SCOPe 2.08: Domain d4h20l2: 4h20 L:108-214

Lineage for d4h20l2 (4h20 L:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4h20l2: 4h20 L:108-214 [222327]
   Other proteins in same PDB: d4h20h_, d4h20l1
   automated match to d1h3pl2

Details for d4h20l2

PDB Entry: 4h20, 1.9 Å

PDB Description: crystal structure and computational modeling of the fab fragment from the protective anti-ricin monoclonal antibody rac18

PDB Compounds: (L:) Light chain of Fab Fragment from the anti-Ricin Monoclonal Antibody RAC18

SCOPe Domain Sequences for d4h20l2:

Sequence; same for both SEQRES and ATOM records:

>d4h20l2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4h20l2:

• d4h20l2 first appeared in SCOPe 2.03
  
• d4h20l2 appears in SCOPe 2.07