SCOPe 2.03: Domain d4h17a_: 4h17 A:

Lineage for d4h17a_ (4h17 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (13 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [226529] (1 PDB entry)

8. Domain d4h17a_: 4h17 A: [222321]
   automated match to d3lqya_
   complexed with edo, so4

Details for d4h17a_

PDB Entry: 4h17, 1.6 Å

PDB Description: crystal structure of an isochorismatase (pp1826) from pseudomonas putida kt2440 at 1.60 a resolution

PDB Compounds: (A:) Hydrolase, isochorismatase family

SCOPe Domain Sequences for d4h17a_:

Sequence; same for both SEQRES and ATOM records:

>d4h17a_ c.33.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
gmsvpttmfrltgrdyppaklshasliiidaqkeylsgplklsgmdeavaniarlldaar
ksgrpiihvrhlgtvggrfdpqgpagqfipgleplegeiviekrmpnafkntklhetlqe
lghldlivcgfmshssvsttvrrakdygyrctlvedasatrdlafkdgvipaaqihqcem
avmadnfacvaptasli

Timeline for d4h17a_:

• d4h17a_ is new in SCOPe 2.03-stable
  
• d4h17a_ appears in SCOPe 2.04
  
• d4h17a_ appears in the current release, SCOPe 2.08, called d4h17a1