Lineage for d4h17a1 (4h17 A:1-196)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445599Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445600Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2445653Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2445654Protein automated matches [190499] (23 species)
    not a true protein
  7. 2445730Species Pseudomonas putida [TaxId:160488] [226529] (1 PDB entry)
  8. 2445731Domain d4h17a1: 4h17 A:1-196 [222321]
    Other proteins in same PDB: d4h17a2
    automated match to d3lqya_
    complexed with edo, so4

Details for d4h17a1

PDB Entry: 4h17 (more details), 1.6 Å

PDB Description: crystal structure of an isochorismatase (pp1826) from pseudomonas putida kt2440 at 1.60 a resolution
PDB Compounds: (A:) Hydrolase, isochorismatase family

SCOPe Domain Sequences for d4h17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h17a1 c.33.1.0 (A:1-196) automated matches {Pseudomonas putida [TaxId: 160488]}
msvpttmfrltgrdyppaklshasliiidaqkeylsgplklsgmdeavaniarlldaark
sgrpiihvrhlgtvggrfdpqgpagqfipgleplegeiviekrmpnafkntklhetlqel
ghldlivcgfmshssvsttvrrakdygyrctlvedasatrdlafkdgvipaaqihqcema
vmadnfacvaptasli

SCOPe Domain Coordinates for d4h17a1:

Click to download the PDB-style file with coordinates for d4h17a1.
(The format of our PDB-style files is described here.)

Timeline for d4h17a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h17a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4h17b_