SCOPe 2.08: Domain d4h0tb2: 4h0t B:147-374

Lineage for d4h0tb2 (4h0t B:147-374)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d4h0tb2: 4h0t B:147-374 [222312]
   Other proteins in same PDB: d4h0ta1, d4h0ta2, d4h0ta3
   automated match to d1qz5a2
   complexed with ar6, atp, ca, edo, lar, po4

Details for d4h0tb2

PDB Entry: 4h0t, 2.2 Å

PDB Description: Crystal structure of Ia-ADPR-actin complex

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d4h0tb2:

Sequence; same for both SEQRES and ATOM records:

>d4h0tb2 c.55.1.1 (B:147-374) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

Timeline for d4h0tb2:

• d4h0tb2 first appeared in SCOPe 2.03
  
• d4h0tb2 appears in SCOPe 2.07