Lineage for d4h0sc_ (4h0s C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733524Species Viridovipera stejnegeri [TaxId:39682] [194681] (3 PDB entries)
  8. 2733527Domain d4h0sc_: 4h0s C: [222310]
    automated match to d1jiaa_
    complexed with na

Details for d4h0sc_

PDB Entry: 4h0s (more details), 1.55 Å

PDB Description: Crystal structure analysis of a basic phospholipase A2 from Trimeresurus stejnegeri venom
PDB Compounds: (C:) Basic phospholipase A2 homolog CTs-R6

SCOPe Domain Sequences for d4h0sc_:

Sequence, based on SEQRES records: (download)

>d4h0sc_ a.133.1.2 (C:) automated matches {Viridovipera stejnegeri [TaxId: 39682]}
sllqlrkmikkmtnkepilsyskygcncgmagrgkpvdatdtccsihnccygkvtscstk
wdsysyswengdivcdekhpckdvcecdkavatcfrdnldtykkrnifhptsscvkvstp
c

Sequence, based on observed residues (ATOM records): (download)

>d4h0sc_ a.133.1.2 (C:) automated matches {Viridovipera stejnegeri [TaxId: 39682]}
sllqlrkmikkmtnkepilsyskygcncgmgkpvdatdtccsihnccygkvcstkwdsys
yswengdivcdekhpckdvcecdkavatcfrdnldtykkrnifhptsscvkvc

SCOPe Domain Coordinates for d4h0sc_:

Click to download the PDB-style file with coordinates for d4h0sc_.
(The format of our PDB-style files is described here.)

Timeline for d4h0sc_: