![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Cryptococcus neoformans [TaxId:5207] [226536] (1 PDB entry) |
![]() | Domain d4h0pb2: 4h0p B:210-434 [222307] automated match to d1g99a2 |
PDB Entry: 4h0p (more details), 1.89 Å
SCOPe Domain Sequences for d4h0pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0pb2 c.55.1.0 (B:210-434) automated matches {Cryptococcus neoformans [TaxId: 5207]} psdqinvvvahlgsgsssccikngksidtsmgltplegllggtrsgtidptaifhhteda asdanvgdftvskaeiilnknsgfkalagttnfghiiqnldpskcseedhekakltyavf ldrllnfvaqylfkllsevpiesidglvfsggigekgaelrrdvlkklawlgaevdeean nsnsggavkcitkegsklkgwvvetdeegwmarmakeefgflehh
Timeline for d4h0pb2: