Lineage for d4h0ia2 (4h0i A:140-251)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297053Domain d4h0ia2: 4h0i A:140-251 [222303]
    automated match to d1dzba2
    complexed with mg, mma

Details for d4h0ia2

PDB Entry: 4h0i (more details), 2.4 Å

PDB Description: crystal structure of scfv-2d10 in complex with methyl alpha-d- mannopyranoside
PDB Compounds: (A:) 2D10 scFv

SCOPe Domain Sequences for d4h0ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0ia2 b.1.1.0 (A:140-251) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpfslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpytfgggtkleik

SCOPe Domain Coordinates for d4h0ia2:

Click to download the PDB-style file with coordinates for d4h0ia2.
(The format of our PDB-style files is described here.)

Timeline for d4h0ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h0ia1