Lineage for d4h0ia2 (4h0i A:140-251)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.0: automated matches [191470] (1 protein)
not a true familyProtein automated matches [190740] (31 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) 
Domain d4h0ia2: 4h0i A:140-251 [222303]
automated match to d1dzba2
complexed with mg, mma
Details for d4h0ia2
PDB Entry: 4h0i (more details), 2.4 Å
PDB Description: crystal structure of scfv-2d10 in complex with methyl alpha-d- mannopyranoside
PDB Compounds: (A:) 2D10 scFvSCOPe Domain Sequences for d4h0ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0ia2 b.1.1.0 (A:140-251) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtpfslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpytfgggtkleik
SCOPe Domain Coordinates for d4h0ia2:
Click to download the PDB-style file with coordinates for d4h0ia2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4h0ia2:
- d4h0ia2 first appeared in SCOPe 2.03
- d4h0ia2 appears in SCOPe 2.07
View in 3D
