Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
Domain d4h0ia1: 4h0i A:1-120 [222302] automated match to d1dzba1 complexed with mg, mma |
PDB Entry: 4h0i (more details), 2.4 Å
SCOPe Domain Sequences for d4h0ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0ia1 b.1.1.0 (A:1-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]} meiqlqqsgpelvkpgasvkisckasgysftdyimlwvkqshgkslewigninpyygsts ynlkfkgkatltvdkssstaymqlnsltsedsavyycarknyygssldywgqgttltvss
Timeline for d4h0ia1: