SCOP 1.75: Domain d1sxzb_: 1sxz B:

Lineage for d1sxzb_ (1sxz B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (21 PDB entries)

8. Domain d1sxzb_: 1sxz B: [22230]
   complexed with ium, nnn; mutant

Details for d1sxzb_

PDB Entry: 1sxz, 2.05 Å

PDB Description: Reduced bovine superoxide dismutase at pH 5.0 complexed with azide

PDB Compounds: (B:) protein (cu-zn superoxide dismutase)

SCOP Domain Sequences for d1sxzb_:

Sequence; same for both SEQRES and ATOM records:

>d1sxzb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxzb_:

• d1sxzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxzb_ appears in SCOP 1.73
  
• d1sxzb_ appears in SCOPe 2.01
  
• d1sxzb_ appears in the current release, SCOPe 2.08