Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species) |
Species Cow (Bos taurus) [TaxId:9913] [49332] (21 PDB entries) |
Domain d1sxzb_: 1sxz B: [22230] complexed with ium, nnn; mutant |
PDB Entry: 1sxz (more details), 2.05 Å
SCOP Domain Sequences for d1sxzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxzb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]} atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek pddlgrggneestktgnagsrlacgvigiak
Timeline for d1sxzb_: