| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (23 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
| Domain d4h0ga1: 4h0g A:1-120 [222298] automated match to d1dzba1 complexed with trs |
PDB Entry: 4h0g (more details), 2.3 Å
SCOPe Domain Sequences for d4h0ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0ga1 b.1.1.0 (A:1-120) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
meiqlqqsgpelvkpgasvkisckasgysftdyimlwvkqshgkslewigninpyygsts
ynlkfkgkatltvdkssstaymqlnsltsedsavyycarknyygssldywgqgttltvss
Timeline for d4h0ga1: