SCOP 1.67: Domain d1sxza_: 1sxz A:

Lineage for d1sxza_ (1sxz A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (16 PDB entries)

8. Domain d1sxza_: 1sxz A: [22229]

Details for d1sxza_

PDB Entry: 1sxz, 2.05 Å

PDB Description: Reduced bovine superoxide dismutase at pH 5.0 complexed with azide

SCOP Domain Sequences for d1sxza_:

Sequence; same for both SEQRES and ATOM records:

>d1sxza_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxza_:

• d1sxza_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxza_ appears in SCOP 1.65
  
• d1sxza_ appears in SCOP 1.69
  
• d1sxza_ appears in the current release, SCOPe 2.08