| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
| Protein D-glucarate dehydratase [51610] (2 species) |
| Species Escherichia coli [TaxId:562] [51612] (7 PDB entries) |
| Domain d4gypb2: 4gyp B:138-446 [222277] Other proteins in same PDB: d4gypa1, d4gypb1, d4gypc1, d4gypc2, d4gypd1, d4gypd2 automated match to d1ec7d1 complexed with cit, gol, mg, p6g, peg, so4 |
PDB Entry: 4gyp (more details), 2.1 Å
SCOPe Domain Sequences for d4gypb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gypb2 c.1.11.2 (B:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr
Timeline for d4gypb2: