SCOPe 2.08: Domain d4gypb1: 4gyp B:4-137

Lineage for d4gypb1 (4gyp B:4-137)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein D-glucarate dehydratase [54831] (2 species)

7. Species Escherichia coli [TaxId:562] [54833] (7 PDB entries)

8. Domain d4gypb1: 4gyp B:4-137 [222276]
   Other proteins in same PDB: d4gypa2, d4gypb2, d4gypc1, d4gypc2, d4gypd1, d4gypd2
   automated match to d1ec7d2
   complexed with cit, gol, mg, p6g, peg, so4

Details for d4gypb1

PDB Entry: 4gyp, 2.1 Å

PDB Description: crystal structure of the heterotetrameric complex of glucd and glucdrp from e. coli k-12 mg1655 (efi target efi-506058)

PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d4gypb1:

Sequence; same for both SEQRES and ATOM records:

>d4gypb1 d.54.1.1 (B:4-137) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
qfttpvvtemqvipvaghdsmlmnlsgahapfftrniviikdnsghtgvgeipggekirk
tledaiplvvgktlgeyknvltlvrntfadrdaggrglqtfdlrttihvvtgieaamldl
lgqhlgvnvasllg

Timeline for d4gypb1:

• d4gypb1 first appeared in SCOPe 2.03
  
• d4gypb1 appears in SCOPe 2.07