![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin [53073] (10 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries) Uniprot P02568 ! SQ 02568 |
![]() | Domain d4gy2b1: 4gy2 B:5-146 [222271] Other proteins in same PDB: d4gy2a1, d4gy2a2 automated match to d1qz5a1 complexed with atp, ca, lar, po4 |
PDB Entry: 4gy2 (more details), 2.71 Å
SCOPe Domain Sequences for d4gy2b1:
Sequence, based on SEQRES records: (download)
>d4gy2b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf etfnvpamyvaiqavlslyasg
>d4gy2b1 c.55.1.1 (B:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ttalvcdngsglvkagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypiehg iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv aiqavlslyasg
Timeline for d4gy2b1: