Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries) |
Domain d4gxob_: 4gxo B: [222262] automated match to d2bv6a1 complexed with gol; mutant |
PDB Entry: 4gxo (more details), 2.05 Å
SCOPe Domain Sequences for d4gxob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxob_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 426430]} gshmylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni sereasdiinnlrnfvs
Timeline for d4gxob_: