SCOPe 2.03: Domain d4gxob_: 4gxo B:

Lineage for d4gxob_ (4gxo B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)

8. Domain d4gxob_: 4gxo B: [222262]
   automated match to d2bv6a1
   complexed with gol; mutant

Details for d4gxob_

PDB Entry: 4gxo, 2.05 Å

PDB Description: Crystal structure of Staphylococcus aureus protein SarZ mutant C13E

PDB Compounds: (B:) MarR family regulatory protein

SCOPe Domain Sequences for d4gxob_:

Sequence; same for both SEQRES and ATOM records:

>d4gxob_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 426430]}
gshmylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgerv
fldsgtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefni
sereasdiinnlrnfvs

Timeline for d4gxob_:

• d4gxob_ is new in SCOPe 2.03-stable
  
• d4gxob_ appears in SCOPe 2.04
  
• d4gxob_ appears in the current release, SCOPe 2.08, called d4gxob1