SCOPe 2.08: Domain d4gxoa1: 4gxo A:7-141

Lineage for d4gxoa1 (4gxo A:7-141)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries)

8. Domain d4gxoa1: 4gxo A:7-141 [222261]
   Other proteins in same PDB: d4gxoa2, d4gxob2
   automated match to d2bv6a1
   complexed with gol; mutant

Details for d4gxoa1

PDB Entry: 4gxo, 2.05 Å

PDB Description: Crystal structure of Staphylococcus aureus protein SarZ mutant C13E

PDB Compounds: (A:) MarR family regulatory protein

SCOPe Domain Sequences for d4gxoa1:

Sequence; same for both SEQRES and ATOM records:

>d4gxoa1 a.4.5.0 (A:7-141) automated matches {Staphylococcus aureus [TaxId: 426430]}
ylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds
gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere
asdiinnlrnfvskn

Timeline for d4gxoa1:

• d4gxoa1 first appeared in SCOPe 2.03, called d4gxoa_
  
• d4gxoa1 appears in SCOPe 2.07