![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:426430] [225722] (4 PDB entries) |
![]() | Domain d4gxoa1: 4gxo A:7-141 [222261] Other proteins in same PDB: d4gxoa2, d4gxob2 automated match to d2bv6a1 complexed with gol; mutant |
PDB Entry: 4gxo (more details), 2.05 Å
SCOPe Domain Sequences for d4gxoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxoa1 a.4.5.0 (A:7-141) automated matches {Staphylococcus aureus [TaxId: 426430]} ylskqleflfyvsskeiikkytnylkeydltytgyivlmaiendeklnikklgervflds gtltpllkklekkdyvvrtreekdernlqislteqgkaiksplaeisvkvfnefnisere asdiinnlrnfvskn
Timeline for d4gxoa1: