SCOPe 2.06: Domain d1sxnb_: 1sxn B:

Lineage for d1sxnb_ (1sxn B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)

8. Domain d1sxnb_: 1sxn B: [22226]
   complexed with ca, cu, zn

Details for d1sxnb_

PDB Entry: 1sxn, 1.9 Å

PDB Description: reduced bovine superoxide dismutase at ph 5.0

PDB Compounds: (B:) cu, zn superoxide dismutase

SCOPe Domain Sequences for d1sxnb_:

Sequence; same for both SEQRES and ATOM records:

>d1sxnb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxnb_:

• d1sxnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxnb_ appears in SCOPe 2.05
  
• d1sxnb_ appears in SCOPe 2.07
  
• d1sxnb_ appears in the current release, SCOPe 2.08