Class a: All alpha proteins [46456] (290 folds) |
Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily) multihelical; 2 layers or orthogonally packed helices |
Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) |
Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins) |
Protein Glycolipid transfer protein, GLTP [110006] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries) Uniprot Q9NZD2 |
Domain d4gxgd_: 4gxg D: [222259] automated match to d1sx6a_ complexed with eis |
PDB Entry: 4gxg (more details), 2.4 Å
SCOPe Domain Sequences for d4gxgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxgd_ a.224.1.1 (D:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]} laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf lvnytatidviyemytqmnaelnykv
Timeline for d4gxgd_: