Lineage for d4gxgb_ (4gxg B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737813Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
    multihelical; 2 layers or orthogonally packed helices
  4. 2737814Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) (S)
  5. 2737815Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)
  6. 2737816Protein Glycolipid transfer protein, GLTP [110006] (2 species)
  7. 2737819Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
    Uniprot Q9NZD2
  8. 2737838Domain d4gxgb_: 4gxg B: [222258]
    automated match to d4gixa_
    complexed with eis

Details for d4gxgb_

PDB Entry: 4gxg (more details), 2.4 Å

PDB Description: Crystal structure of human GLTP bound with 12:0 monosulfatide (orthorhombic form; four subunits in asymmetric unit)
PDB Compounds: (B:) glycolipid transfer protein

SCOPe Domain Sequences for d4gxgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxgb_ a.224.1.1 (B:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydt
npakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpn
lirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirl
flvnytatidviyemytqmnaelnykv

SCOPe Domain Coordinates for d4gxgb_:

Click to download the PDB-style file with coordinates for d4gxgb_.
(The format of our PDB-style files is described here.)

Timeline for d4gxgb_: