![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily) multihelical; 2 layers or orthogonally packed helices |
![]() | Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) ![]() |
![]() | Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins) |
![]() | Protein Glycolipid transfer protein, GLTP [110006] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries) Uniprot Q9NZD2 |
![]() | Domain d4gxga_: 4gxg A: [222257] automated match to d4gixa_ complexed with eis |
PDB Entry: 4gxg (more details), 2.4 Å
SCOPe Domain Sequences for d4gxga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gxga_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]} mallaehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy dtnpakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeecleki rlflvnytatidviyemytqmnaelnykv
Timeline for d4gxga_: