Lineage for d4gwga2 (4gwg A:177-469)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742413Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 1742439Protein automated matches [227013] (1 species)
    not a true protein
  7. 1742440Species Human (Homo sapiens) [TaxId:9606] [225747] (2 PDB entries)
  8. 1742441Domain d4gwga2: 4gwg A:177-469 [222236]
    Other proteins in same PDB: d4gwga1
    automated match to d2pgda1
    complexed with mes

Details for d4gwga2

PDB Entry: 4gwg (more details), 1.39 Å

PDB Description: crystal structure analysis of 6-phosphogluconate dehydrogenase apo- form
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d4gwga2:

Sequence, based on SEQRES records: (download)

>d4gwga2 a.100.1.1 (A:177-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita
nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqag
ipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt

Sequence, based on observed residues (ATOM records): (download)

>d4gwga2 a.100.1.1 (A:177-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita
nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggia
lmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagip
mpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt

SCOPe Domain Coordinates for d4gwga2:

Click to download the PDB-style file with coordinates for d4gwga2.
(The format of our PDB-style files is described here.)

Timeline for d4gwga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gwga1