![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
![]() | Protein automated matches [227013] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225747] (2 PDB entries) |
![]() | Domain d4gwga2: 4gwg A:177-469 [222236] Other proteins in same PDB: d4gwga1 automated match to d2pgda1 complexed with mes |
PDB Entry: 4gwg (more details), 1.39 Å
SCOPe Domain Sequences for d4gwga2:
Sequence, based on SEQRES records: (download)
>d4gwga2 a.100.1.1 (A:177-469) automated matches {Human (Homo sapiens) [TaxId: 9606]} gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder iqaskklkgpqkfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg ialmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqag ipmpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt
>d4gwga2 a.100.1.1 (A:177-469) automated matches {Human (Homo sapiens) [TaxId: 9606]} gaghfvkmvhngieygdmqliceayhlmkdvlgmaqdemaqafedwnkteldsflieita nilkfqdtdgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder iqaskklkgpfqfdgdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnyggia lmwrggciirsvflgkikdafdrnpelqnlllddffksavencqdswrravstgvqagip mpcfttalsfydgyrhemlpasliqaqrdyfgahtyellakpgqfihtnwt
Timeline for d4gwga2: