SCOP 1.73: Domain d1sxaa_: 1sxa A:

Lineage for d1sxaa_ (1sxa A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (11 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (17 PDB entries)

8. Domain d1sxaa_: 1sxa A: [22223]

Details for d1sxaa_

PDB Entry: 1sxa, 1.9 Å

PDB Description: crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution

PDB Compounds: (A:) superoxide dismutase

SCOP Domain Sequences for d1sxaa_:

Sequence; same for both SEQRES and ATOM records:

>d1sxaa_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxaa_:

• d1sxaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxaa_ appears in SCOP 1.71
  
• d1sxaa_ appears in SCOP 1.75
  
• d1sxaa_ appears in the current release, SCOPe 2.08