Lineage for d4gw4l1 (4gw4 L:4-96)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757161Domain d4gw4l1: 4gw4 L:4-96 [222227]
    Other proteins in same PDB: d4gw4b2, d4gw4l2
    automated match to d1rhha1
    complexed with nag; mutant

Details for d4gw4l1

PDB Entry: 4gw4 (more details), 2.65 Å

PDB Description: crystal structure of 3bnc60 fab with p61a mutation
PDB Compounds: (L:) 3BNC60 Fab Light-chain

SCOPe Domain Sequences for d4gw4l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gw4l1 b.1.1.0 (L:4-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsgrrw
gqeynltinnlqpedvatyfcqvyefivpgtrldlk

SCOPe Domain Coordinates for d4gw4l1:

Click to download the PDB-style file with coordinates for d4gw4l1.
(The format of our PDB-style files is described here.)

Timeline for d4gw4l1: