![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
![]() | Protein Arginine kinase, C-terminal domain [55942] (2 species) |
![]() | Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (14 PDB entries) Uniprot P51541 |
![]() | Domain d4gw2a2: 4gw2 A:96-357 [222224] Other proteins in same PDB: d4gw2a1 automated match to d1m15a2 complexed with adp, mg, no3, orn |
PDB Entry: 4gw2 (more details), 2.16 Å
SCOPe Domain Sequences for d4gw2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gw2a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte yqavremqdgilemikmekaaa
Timeline for d4gw2a2: