SCOPe 2.05: Domain d4gw2a1: 4gw2 A:2-95

Lineage for d4gw2a1 (4gw2 A:2-95)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Arginine kinase, N-domain [48042] (2 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (11 PDB entries)
   Uniprot P51541

8. Domain d4gw2a1: 4gw2 A:2-95 [222223]
   Other proteins in same PDB: d4gw2a2
   automated match to d1m15a1
   complexed with adp, mg, no3, orn

Details for d4gw2a1

PDB Entry: 4gw2, 2.16 Å

PDB Description: crystal structure of arginine kinase in complex with l-ornithine, mgadp, and nitrate.

PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d4gw2a1:

Sequence; same for both SEQRES and ATOM records:

>d4gw2a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

Timeline for d4gw2a1:

• d4gw2a1 first appeared in SCOPe 2.03
  
• d4gw2a1 appears in SCOPe 2.04
  
• d4gw2a1 appears in SCOPe 2.06
  
• d4gw2a1 appears in the current release, SCOPe 2.08