Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
Protein Arginine kinase, C-terminal domain [55942] (2 species) |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (14 PDB entries) Uniprot P51541 |
Domain d4gw0a2: 4gw0 A:96-357 [222222] Other proteins in same PDB: d4gw0a1 automated match to d1m15a2 complexed with adp, ilo, mg, no3 |
PDB Entry: 4gw0 (more details), 2.45 Å
SCOPe Domain Sequences for d4gw0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gw0a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte yqavremqdgilemikmekaaa
Timeline for d4gw0a2: