SCOPe 2.08: Domain d1sxbb_: 1sxb B:

Lineage for d1sxbb_ (1sxb B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)

8. Domain d1sxbb_: 1sxb B: [22222]
   complexed with cu, zn

Details for d1sxbb_

PDB Entry: 1sxb, 2 Å

PDB Description: crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d1sxbb_:

Sequence; same for both SEQRES and ATOM records:

>d1sxbb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d1sxbb_:

• d1sxbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sxbb_ appears in SCOPe 2.07