Class a: All alpha proteins [46456] (286 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Arginine kinase, N-domain [48042] (2 species) |
Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (11 PDB entries) Uniprot P51541 |
Domain d4gvza1: 4gvz A:2-95 [222219] Other proteins in same PDB: d4gvza2 automated match to d1m15a1 complexed with adp, dar, mg, no3 |
PDB Entry: 4gvz (more details), 2.96 Å
SCOPe Domain Sequences for d4gvza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gvza1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl dsgvgiyapdaesyrtfgplfdpiiddyhggfkl
Timeline for d4gvza1: