Lineage for d1sxba_ (1sxb A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10106Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 10107Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 10118Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 10136Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)
  8. 10145Domain d1sxba_: 1sxb A: [22221]

Details for d1sxba_

PDB Entry: 1sxb (more details), 2 Å

PDB Description: crystal structure of reduced bovine erythrocyte superoxide dismutase at 1.9 angstroms resolution

SCOP Domain Sequences for d1sxba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxba_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOP Domain Coordinates for d1sxba_:

Click to download the PDB-style file with coordinates for d1sxba_.
(The format of our PDB-style files is described here.)

Timeline for d1sxba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sxbb_