SCOPe 2.04: Domain d4gv4a1: 4gv4 A:176-321

Lineage for d4gv4a1 (4gv4 A:176-321)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225405] (24 PDB entries)

8. Domain d4gv4a1: 4gv4 A:176-321 [222194]
   Other proteins in same PDB: d4gv4a2
   automated match to d1gs0a1
   complexed with dms, mej

Details for d4gv4a1

PDB Entry: 4gv4, 1.8 Å

PDB Description: human artd3 (parp3) - catalytic domain in complex with inhibitor me0328

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4gv4a1:

Sequence; same for both SEQRES and ATOM records:

>d4gv4a1 a.41.1.0 (A:176-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
qalqavseqektveevphpldrdyql

Timeline for d4gv4a1:

• d4gv4a1 first appeared in SCOPe 2.03
  
• d4gv4a1 appears in SCOPe 2.05
  
• d4gv4a1 appears in the current release, SCOPe 2.08