SCOPe 2.03: Domain d4gv2a2: 4gv2 A:322-532

Lineage for d4gv2a2 (4gv2 A:322-532)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (19 PDB entries)

8. Domain d4gv2a2: 4gv2 A:322-532 [222193]
   Other proteins in same PDB: d4gv2a1
   automated match to d1gs0a2
   complexed with 5me, dms

Details for d4gv2a2

PDB Entry: 4gv2, 1.8 Å

PDB Description: human artd3 (parp3) - catalytic domain in complex with inhibitor me0354

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4gv2a2:

Sequence; same for both SEQRES and ATOM records:

>d4gv2a2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl
lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl
gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp
cpefssstfsqseyliyqesqcrlryllevh

Timeline for d4gv2a2:

• d4gv2a2 is new in SCOPe 2.03-stable
  
• d4gv2a2 appears in SCOPe 2.04
  
• d4gv2a2 appears in the current release, SCOPe 2.08