Lineage for d4gv0a1 (4gv0 A:178-321)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712204Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2712205Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2712230Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2712231Protein automated matches [226964] (2 species)
    not a true protein
  7. 2712235Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries)
  8. 2712240Domain d4gv0a1: 4gv0 A:178-321 [222190]
    Other proteins in same PDB: d4gv0a2, d4gv0a3
    automated match to d1gs0a1
    complexed with 8me, dms

Details for d4gv0a1

PDB Entry: 4gv0 (more details), 1.9 Å

PDB Description: human artd3 (parp3) - catalytic domain in complex with inhibitor me0355
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4gv0a1:

Sequence, based on SEQRES records: (download)

>d4gv0a1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqa
lqavseqektveevphpldrdyql

Sequence, based on observed residues (ATOM records): (download)

>d4gv0a1 a.41.1.0 (A:178-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
ealkdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqalqa
vseqektveevphpldrdyql

SCOPe Domain Coordinates for d4gv0a1:

Click to download the PDB-style file with coordinates for d4gv0a1.
(The format of our PDB-style files is described here.)

Timeline for d4gv0a1: