Lineage for d4gumh_ (4gum H:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421487Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1421488Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1421611Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 1421620Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 1421798Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226713] (1 PDB entry)
  8. 1421806Domain d4gumh_: 4gum H: [222187]
    automated match to d1gd0a_
    complexed with cl

Details for d4gumh_

PDB Entry: 4gum (more details), 2.33 Å

PDB Description: cystal structure of locked-trimer of human mif
PDB Compounds: (H:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d4gumh_:

Sequence, based on SEQRES records: (download)

>d4gumh_ d.80.1.3 (H:) Microphage migration inhibition factor (MIF) {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwncs

Sequence, based on observed residues (ATOM records): (download)

>d4gumh_ d.80.1.3 (H:) Microphage migration inhibition factor (MIF) {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsiiggaqnrsyskllcgllaerlrispdrvyinyydmcs

SCOPe Domain Coordinates for d4gumh_:

Click to download the PDB-style file with coordinates for d4gumh_.
(The format of our PDB-style files is described here.)

Timeline for d4gumh_: