SCOP 1.65: Domain d1e9qb_: 1e9q B:

Lineage for d1e9qb_ (1e9q B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (15 PDB entries)

8. Domain d1e9qb_: 1e9q B: [22218]
   complexed with cu, zn; mutant

Details for d1e9qb_

PDB Entry: 1e9q, 1.75 Å

PDB Description: crystal structure of bovine cu zn sod - (1 of 3)

SCOP Domain Sequences for d1e9qb_:

Sequence; same for both SEQRES and ATOM records:

>d1e9qb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus)}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdderhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneeststgnagsrlacgvigiak

Timeline for d1e9qb_:

• d1e9qb_ first appeared (with stable ids) in SCOP 1.55
  
• d1e9qb_ appears in SCOP 1.63
  
• d1e9qb_ appears in SCOP 1.67
  
• d1e9qb_ appears in the current release, SCOPe 2.08