Lineage for d4guja_ (4guj A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097472Protein automated matches [190095] (24 species)
    not a true protein
  7. 2097688Species Salmonella enterica [TaxId:99287] [189300] (4 PDB entries)
  8. 2097689Domain d4guja_: 4guj A: [222178]
    automated match to d3m7wa_
    complexed with skm, zn

Details for d4guja_

PDB Entry: 4guj (more details), 1.5 Å

PDB Description: 1.50 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) in complex with shikimate
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4guja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4guja_ c.1.10.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
ktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesv
leaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgd
devkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadv
ltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisvad
lrtvltilhqa

SCOPe Domain Coordinates for d4guja_:

Click to download the PDB-style file with coordinates for d4guja_.
(The format of our PDB-style files is described here.)

Timeline for d4guja_: