SCOPe 2.06: Domain d4guib_: 4gui B:

Lineage for d4guib_ (4gui B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (24 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [189300] (4 PDB entries)

8. Domain d4guib_: 4gui B: [222177]
   automated match to d3m7wa_
   complexed with ni, qic

Details for d4guib_

PDB Entry: 4gui, 1.78 Å

PDB Description: 1.78 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) in complex with quinate

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4guib_:

Sequence; same for both SEQRES and ATOM records:

>d4guib_ c.1.10.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
ktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesv
leaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgd
devkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadv
ltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisvad
lrtvltilhqa

Timeline for d4guib_:

• d4guib_ first appeared in SCOPe 2.03
  
• d4guib_ appears in SCOPe 2.05
  
• d4guib_ appears in SCOPe 2.07
  
• d4guib_ appears in the current release, SCOPe 2.08