Lineage for d4guib_ (4gui B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342159Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1342672Protein automated matches [190095] (17 species)
    not a true protein
  7. 1342795Species Salmonella enterica [TaxId:99287] [189300] (4 PDB entries)
  8. 1342799Domain d4guib_: 4gui B: [222177]
    automated match to d3m7wa_
    complexed with ni, qic

Details for d4guib_

PDB Entry: 4gui (more details), 1.78 Å

PDB Description: 1.78 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) in complex with quinate
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4guib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4guib_ c.1.10.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
ktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesv
leaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgd
devkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadv
ltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisvad
lrtvltilhqa

SCOPe Domain Coordinates for d4guib_:

Click to download the PDB-style file with coordinates for d4guib_.
(The format of our PDB-style files is described here.)

Timeline for d4guib_: